<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LV_02CM-CK1_18 02CM-18 Cameroon 2002 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V21I, V35T, T39E, S48T, V60I, V118I, K122E, I135T, E138A, T139A, I142V, S162C, R172K, D177E, I178L, V179T, G196E, T200A, E204K, Q207E, R211K, F214L, I244V, V245T, D250E, A272P, K275Q, T286A, E297K, K311R, S322ST, I329V, Q334E, T338S, Y339W, I341V, R356K, K374R, K390R, E399D, T403M Q182S
>02CM-18| codons 1-428
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNAAPGVRYQYNVLPQGWKGSPAIFQCSMTKILEPFKKQNPELTI
YSYMDDLYVGSDLEIEQHRAKIEKLREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPVTLPEKESWTVNDIQKLVGKLNWASQIYPGIQVKQLCKLLRGAKALTEVIPLTKEAE
LELAENREILREPVHGVYYDPTKDLIAEVQKQGEGQWSWQVYQEPFKNLKTGKYAKMRGA
HTNDVKQLTEAVQRIATESIVIWGKTPKFRLPIQKETWDAWWMEYWQATWIPEWEFVNTP
PLVKLWYQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  Q58E L10V, E35D, M36IL, N37E, R41K, R57K, Q61D, L63P, H69Q D60T
>02CM-18| codons 1-99
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEDLELPGKWKPKMIGGIGGFIKVKEYT
DIPIEICGQKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Vergne, L Natural polymorphism in protease and reverse transcriptase genes and in vitro antiretroviral drug susceptibilities of non-B HIV-1 strains from treatment-naive patients. J Clin Virol, 2006