<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LV_01CM-VP_OU_52 01CM-OU_52 Cameroon 2001 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, T12N, I15V, K20R, E35D, M36I, R41K, L63Q, H69Q, V82I, L89M I62G
>01CM-OU_52| codons 1-99
PQITLWQRPVVNIKVGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QGQIEICGQKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        I31L, V35T, D123E, I142V, K173T, Q174K, D177E, I178L, Q207E, P243A, V245Q, E248D, D250S, A272P, K275R, Q278H, T286A, E291D, I293V, E297A, L303M, Q334H, G335D, F346H, R356K, M357R, G359S, A371V, A376S, T386I, K390R, E399D, A400T, T403A, K431T  
>01CM-OU_52| codons 1-433
PISPIETVPVKLKPGMDGPKVKQWPLTEEKLKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPELVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQAIQLPDKSSWTVNDIQKLVGKLNWASQIYPGIRVKHLCKLLRGAKALTDVVPLTAEAE
LEMAENREILKEPVHGVYYDPSKDLIAEIQKQGHDQWTYQIYQEPHKNLKTGKYAKRRSA
HTNDVKQLTEVVQKISTESIVIWGKIPKFRLPIQKETWDTWWAEYWQATWIPEWEFVNTP
PLVKLWYQLETEP

References
Author Title Citation
Vergne, L Natural polymorphism in protease and reverse transcriptase genes and in vitro antiretroviral drug susceptibilities of non-B HIV-1 strains from treatment-naive patients. J Clin Virol, 2006