<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LV_00GB-LBV03_09 00GB-03_09 Gabon 2000 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, G16E, K20I, M36I, R41K, L63H, H69K, L89M  
>00GB-03_09| codons 1-99
PQITLWQRPLVTVRIEGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIHIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36D, T39S, K101Q, K122E, S162A, K173T, Q174K, D177E, I178M, T200A, Q207E, P243H, V245Q, T286A, E291D, I293V, P294T, S322T, I326V, G335D, R356K, M357R, G359S, A371V, I375V, T377V, K390R, K395R, E432D  
>00GB-03_09| codons 1-439
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICSEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEMVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQHIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDVVTLTEEAE
LELAENREILKEPVHGVYYDPTKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKRRSA
HTNDVKQLTEVVQKVAVESIVIWGKTPKFRLPIQRETWEAWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIVGAET

References
Author Title Citation
Vergne, L Natural polymorphism in protease and reverse transcriptase genes and in vitro antiretroviral drug susceptibilities of non-B HIV-1 strains from treatment-naive patients. J Clin Virol, 2006