<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
YK_04CM024 YK_04CM024 Cameroon 2004 HIV1 G PBMC Cons

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    Q2P, L10I, I13V, I15V, K20I, E35D, M36I, R41K, D60E, C67S, H69Q, V82I, L89M  
>YK_04CM024| codons 1-99
PPITLWQRPIVTVKVGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYE
QILIEISGQKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      V179E V35T, E40D, K49R, V60I, A98S, K102Q, K122E, D123N, Q174K, D177E, I178M, T200A, Q207N, R211K  
>YK_04CM024| codons 1-220
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKQKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKKNPEMEI
YQYMDDLYVGSDLEIGQHRAKIEELRNHLLKWGFTTPDKK

References
Author Title Citation
Koizumi, Y Emergence of antiretroviral therapy resistance-associated primary mutations among drug-naive HIV-1-infected individuals in rural western Cameroon. JAIDS, 2006