<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
YK_04CM007 YK_04CM007 Cameroon 2004 HIV1 A PBMC Cons

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35N, M36I, N37D, R41K, L63P, H69K, L89M  
>YK_04CM007| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLENIDLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11T, K32R, V35T, S48T, V60I, D121Y, K122E, E169D, K173A, Q174K, D177E, G196E, Q207A, R211S, F214L K66T, N81I
>YK_04CM007| codons 1-220
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIRALTEICTEMEKEGKITKIGPENPYNTPI
FAIKKTDSTKWRKLVDFRELIKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRAKNPEIVI
YQYMDDLYVGSDLEIEQHRTKIEELRAHLLSWGLTTPDKK

References
Author Title Citation
Koizumi, Y Emergence of antiretroviral therapy resistance-associated primary mutations among drug-naive HIV-1-infected individuals in rural western Cameroon. JAIDS, 2006