Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| CA364 | CA663 | U.S. | 1995 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | SQV | 24 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| I15V, E35D, L38F, R41K, I62V, L63H, R87X, I93L |
| >CA663| codons 1-99 PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDMNFPGKWKPKMIGGIGGFIKVRQYD QVHIEICGHKAIGTVLVGPTPVNIIGXNLLTQLGCTLNF |
References
| Author | Title | Citation |
| Schapiro, JM | The effect of high-dose saquinavir on viral load and CD4+ T-cell counts in HIV-infected patients. | Ann Intern Med, 1996 |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |