<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA364 CA663 U.S. 1995 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 SQV 24

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, E35D, L38F, R41K, I62V, L63H, R87X, I93L  
>CA663| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDMNFPGKWKPKMIGGIGGFIKVRQYD
QVHIEICGHKAIGTVLVGPTPVNIIGXNLLTQLGCTLNF

References
Author Title Citation
Schapiro, JM The effect of high-dose saquinavir on viral load and CD4+ T-cell counts in HIV-infected patients. Ann Intern Med, 1996
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005