<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ_03GEMZ015 03GEMZ015 Republic Of Georgia 2003 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35I, K122Q, I135T, D177G, E194K, Q207E  
>03GEMZ015| codons 1-238
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DQDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPGIVI
YQYVDDLYVGSDLKIGQHRTKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L33V, N37Y, I62V, L63P, I64L, H69Q  
>03GEMZ015| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVVEEMYLPGRWKPKMIGGIGGFIKVRQYD
QVPLEICGQKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Zarandia, M HIV-1 genetic diversity and genotypic drug susceptibility in the Republic of Georgia. ARHR, 2006