<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ_03GEMZ012 03GEMZ012 Republic Of Georgia 2003 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19I, E35D, M36I, R41K, C67Y, H69K, L89I, I93L  
>03GEMZ012| codons 1-99
PQITLWQRPLVTIKIGGQIKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEIYGKKAIGTVLVGPTPVNIIGRNILTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, V35T, E36D, T39K, K122E, D123S, A158S, K173L, Q174K, Q207A, R211S  
>03GEMZ012| codons 1-238
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALTDICKEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRLKNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDK

References
Author Title Citation
Zarandia, M HIV-1 genetic diversity and genotypic drug susceptibility in the Republic of Georgia. ARHR, 2006