<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AV_M9443N AV_M9443N Cameroon 2003 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14KR, K20KI, E35DN, M36I, N37D, R41K, I62V, L63P, H69K, L89M  
>AV_M9443N| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLENIDLPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        D121Y, K122E, D123G, I135T, S162A, K173A, Q174R, D177E, E203D, Q207S, R211S, V245Q  
>AV_M9443N| codons 40-247
EMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAG
LKKKKSVTVLDVGDAYFSVPLYEGFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAI
FQASMTKILEPFRARNPEIVIYQYMDDLYVGSDLEIGQHRTKIDELRSHLLSWGFTTPDK
KHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Vessiere, A HIV-1 pol gene polymorphism and antiretroviral resistance mutations in drug-naive pregnant women in Yaounde, Cameroon. JAIDS, 2006