<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AV_M9416N AV_M9416N Cameroon 2003 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, E35D, M36I, N37D, R41K  
>AV_M9416N| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39L, V60I, K64R, E169D, D177E, I178L, T200A, Q207E, F214L  
>AV_M9416N| codons 2-241
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICLEMEKEGKISKIGPENPYNTPIF
AIRKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPELVIY
QYMDDLYVGSDLEIGQHRAKIEELREHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTV

References
Author Title Citation
Vessiere, A HIV-1 pol gene polymorphism and antiretroviral resistance mutations in drug-naive pregnant women in Yaounde, Cameroon. JAIDS, 2006