<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AV_M9312N AV_M9312N Cameroon 2003 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, L19Q, E35D, M36I, R41K, R57K, D60E, L63P, H69K, L89M  
>AV_M9312N| codons 1-99
PQITLWQRPLVTVRIGGQQKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYE
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39K, K104R, K122E, D123N, I135T, S162SG, K173S, Q174K, V179I, Q197L, Q207E, V245Q  
>AV_M9312N| codons 3-255
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKEMEKEGKISKIGPENPYNTPVFA
IKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPLDE
NFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQGSMTKILEPFRSKNPDIIIYQ
YMDDLYVGSDLEIGLHRTKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQ
PIQLPEKDSWTVN

References
Author Title Citation
Vessiere, A HIV-1 pol gene polymorphism and antiretroviral resistance mutations in drug-naive pregnant women in Yaounde, Cameroon. JAIDS, 2006