<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AV_M9119N AV_M9119N Cameroon 2003 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13A, K14R, K20I, E35D, M36I, R41K, L63P, H69K, L89M N98NS
>AV_M9119N| codons 1-99
PQITLWQRPLVTARIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLSF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39K, K43E, K49R, V106I, K122E, D123S, I135T, S162C, K173S, V179I, T200I, Q207A  
>AV_M9119N| codons 33-242
ALTAICKEMEEEGKISRIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQL
GIPHPAGLKKKKSITVLDVGDAYFSVPLDESFRKYTAFTIPSTNNETPGIRYQYNVLPQG
WKGSPAIFQCSMTKILEPFRSQNPDIIIYQYMDDLYVGSDLEIGQHRIKIEELRAHLLRW
GFTTPDKKHQKEPPFLWMGYELHPDKWTVQ

References
Author Title Citation
Vessiere, A HIV-1 pol gene polymorphism and antiretroviral resistance mutations in drug-naive pregnant women in Yaounde, Cameroon. JAIDS, 2006