<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AV_M6188N AV_M6188N Cameroon 2003 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39E, E40D, V60I, S68G, I135V, S162A, P170T, K173T, Q174K, D177E, I178M, G196E, T200A, Q207E, V245Q  
>AV_M6188N| codons 22-257
KQWPLTEEKIKALTEICEDMEKEGKISKIGPENPYNTPIFAIKKKDGTKWRKLVDFRELN
KRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSVNNETPG
IRYQYNVLPQGWKGSPAIFQASMTKILETFRTKNPEMVIYQYMDDLYVGSDLEIEQHRAK
IEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIQLPEKDSWTVNDI

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20I, E34A, M36I, R41K, H69K, L89M  
>AV_M6188N| codons 1-99
PQITLWQRPLVTVKIGGQLIEALLDTGADDTVLAEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Vessiere, A HIV-1 pol gene polymorphism and antiretroviral resistance mutations in drug-naive pregnant women in Yaounde, Cameroon. JAIDS, 2006