<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AV_M5348N AV_M5348N Cameroon 2003 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, G16E, E35D, M36I, R57K, L63T, H69K, K70R, L89M  
>AV_M5348N| codons 1-99
PQITLWQRPIVTVKIEGQLKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVKQYD
QITIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      V179D E6K, K11T, V35T, T39TA, V118I, D121E, K122E, D123S, I142V, K173S, Q174K, I202V, Q207A, R211S, F214L, V245Q, E248D  
>AV_M5348N| codons 1-255
PISPIKTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
EESFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPDIDI
YQYMDDLYVGSDLEIGQHRTKVEELRAHLLSWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVN

References
Author Title Citation
Vessiere, A HIV-1 pol gene polymorphism and antiretroviral resistance mutations in drug-naive pregnant women in Yaounde, Cameroon. JAIDS, 2006