<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AV_M4896N AV_M4896N Cameroon 2003 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35N, M36I, N37D, R41K, R57K, H69K, L89M  
>AV_M4896N| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLENIDLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39L, V60I, D121C, K122E, I135T, I142V, S162A, Q174E, D177E, T200A, Q207A, R211K  
>AV_M4896N| codons 19-240
PKVKQWPLTEEKIKALTEICLEMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFR
ELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLCEDFRKYTAFTIPSTNNE
TPGVRYQYNVLPQGWKGSPAIFQASMTKILEPFRKENPEIVIYQYMDDLYVGSDLEIGQH
RAKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT

References
Author Title Citation
Vessiere, A HIV-1 pol gene polymorphism and antiretroviral resistance mutations in drug-naive pregnant women in Yaounde, Cameroon. JAIDS, 2006