<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AV_M4606N AV_M4606N Cameroon 2003 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16E, G17DE, K20KR, E35D, M36L, R41K, L63A, H69K, K70R, L89M, T91V, I93L  
>AV_M4606N| codons 1-99
PQITLWQRPLVTVKIEEQLREALLDTGADDTVLEDLNLPGKWKPKMIGGIGGFIKVRQYD
QIAIEICGKRAIGTVLVGPTPVNIIGRNMLVQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39K, D121H, K122E, I142V, A158S, K173S, Q174KR, D177E, I178L, T200A, E204D, Q207N, R211K, V245K  
>AV_M4606N| codons 14-254
PGMDGPKVKQWPLTEEKIKALTEICKEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRK
LVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLHEDFRKYTAFTIP
SINNETPGVRYQYNVLPQGWKGSPSIFQSSMTKILEPFRSRNPELVIYQYMDDLYVGSDL
EIGQHRAKIEDLRNHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIKLPEKDSWT
V

References
Author Title Citation
Vessiere, A HIV-1 pol gene polymorphism and antiretroviral resistance mutations in drug-naive pregnant women in Yaounde, Cameroon. JAIDS, 2006