<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AV_M4587N AV_M4587N Cameroon 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  V32VA K14R, I15V, E35D, M36I, R41K, L63P, H69Q  
>AV_M4587N| codons 1-99
PQITLWQRPLVTIRVGGQLKEALLDTGADDTALEDINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGQKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L210W T215S     V35T, T39S, S68G, I135T, S162A, K173T, Q174K, T200TA, Q207E, R211K, V245Q, E248D  
>AV_M4587N| codons 2-255
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICSEMEKEGKISKIGPENPYNTPVF
AIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPDIVIY
QYMDDLYVGSDLEIGQHRAKIEELREHLWKWGFSTPDKKHQKEPPFLWMGYELHPDKWTV
QPIQLPDKDSWTVN

References
Author Title Citation
Vessiere, A HIV-1 pol gene polymorphism and antiretroviral resistance mutations in drug-naive pregnant women in Yaounde, Cameroon. JAIDS, 2006