<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AV_M4415N AV_M4415N Cameroon 2003 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, G16E, K20V, E35D, M36I, L63V, H69K, L89M  
>AV_M4415N| codons 1-99
PQITLWQRPIVTVKIEGQLVEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, K122E, D123NS, I142V, K173S, I178IM, I202V, Q207A, R211S, F214L  
>AV_M4415N| codons 14-242
PGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRK
LVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIP
SINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSQNPDMVIYQYMDDLYVGSDL
EIGQHRTKVEELRAHLLSWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQ

References
Author Title Citation
Vessiere, A HIV-1 pol gene polymorphism and antiretroviral resistance mutations in drug-naive pregnant women in Yaounde, Cameroon. JAIDS, 2006