<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AV_M4091N AV_M4091N Cameroon 2003 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, E35G, M36I, R41K, I64M, H69K, L89M  
>AV_M4091N| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEGINLPGKWKPKMIGGIGGFIKVRQYD
QILMEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, K43KN, S48T, K49R, V60I, V90I, A98S, I135V, I142V, S162A, K173T, Q174K, D177E, T200A, Q207A, R211K, V245Q, E248D  
>AV_M4091N| codons 15-255
GMDGPKVKQWPLTEEKIKALTEICTEMENEGKITRIGPENPYNTPIFAIKKKDSTKWRKL
VDFRELNKRTQDFWEIQLGIPHPSGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPS
VNNETPGVRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVIYQYMDDLYVGSDLE
IGQHRAKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIQLPDKDSWTV
N

References
Author Title Citation
Vessiere, A HIV-1 pol gene polymorphism and antiretroviral resistance mutations in drug-naive pregnant women in Yaounde, Cameroon. JAIDS, 2006