<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AV_M3652N AV_M3652N Cameroon 2003 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G17E, K20I, E35K, M36I, R41K, H69K, K70R, L89M  
>AV_M3652N| codons 1-99
PQITLWQRPLVTVKIGEQLIEALLDTGADDTVLEKINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39L, V60I, D121C, K122E, I135T, I142V, S162A, E169Q, K173D, Q174K, D177K, T200A, Q207E, R211K, V245N  
>AV_M3652N| codons 12-255
LKPGMDGPKVKQWPLTEEKIKALTEICLEMEKEGKISKIGPENPYNTPIFAIKKKDSTKW
RKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLCEDFRKYTAFT
IPSTNNETPGVRYQYNVLPQGWKGSPAIFQASMTKILQPFRDKNPKIVIYQYMDDLYVGS
DLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPINLPEKDS
WTVN

References
Author Title Citation
Vessiere, A HIV-1 pol gene polymorphism and antiretroviral resistance mutations in drug-naive pregnant women in Yaounde, Cameroon. JAIDS, 2006