<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AV_M3348N AV_M3348N Cameroon 2003 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, E35N, M36I, R41K, H69K, L89M  
>AV_M3348N| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLENINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K49R, K122E, I135K, S162A, E169K, K173T, Q174K, N175H, D177E, I178M, T200A, E203D, Q207E, F214L, V245Q  
>AV_M3348N| codons 37-255
ICTEMEKEGKISRIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPH
PAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSKNNETPGIRYQYNVLPQGWKGS
PAIFQASMTKILKPFRTKHPEMVIYQYMDDLYVGSDLEIGQHRAKIDELREHLLRWGLTT
PDKKHQKEPPFLWMGYELHPDKWTVQPIQLPEKDSWTVN

References
Author Title Citation
Vessiere, A HIV-1 pol gene polymorphism and antiretroviral resistance mutations in drug-naive pregnant women in Yaounde, Cameroon. JAIDS, 2006