<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AV_M2826N AV_M2826N Cameroon 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, I15V, E35D, M36I, R41K, H69Q, L89M  
>AV_M2826N| codons 1-99
PQITLWQRPIVTVKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGQKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V35T, D123E, S162A, K173A, Q174K, D177E, G196E, Q207E, R211K, P243A, V245Q, D250S  
>AV_M2826N| codons 13-255
KPGMDGPRVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWR
KLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTI
PSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRAKNPEIVIYQYMDDLYVGSD
LEIEQHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQAIQLPEKSSW
TVN

References
Author Title Citation
Vessiere, A HIV-1 pol gene polymorphism and antiretroviral resistance mutations in drug-naive pregnant women in Yaounde, Cameroon. JAIDS, 2006