<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AV_M10066N AV_M10066N Cameroon 2003 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, V11T, I13V, K14R, K20I, E35D, M36L, R41K, L63P, H69K, L89M  
>AV_M10066N| codons 1-99
PQITLWQRPITTVRIGGQLIEALLDTGADDTVLEDLNLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6T, K11S, V35T, T39N, K49R, V60I, K122E, D123N, I135T, I142V, T165TI, E169Q, K173E, D177E, T200A, Q207A, R211K, V245Q, E248D  
>AV_M10066N| codons 3-255
SPITTVPVSLKPGMDGPKVKQWPLTEEKIKALTEICNEMEKEGKISRIGPENPYNTPIFA
IKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDE
NFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMIKILQPFREQNPEIVIYQ
YMDDLYVGSDLEIGQHRAKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQ
PIQLPDKDSWTVN

References
Author Title Citation
Vessiere, A HIV-1 pol gene polymorphism and antiretroviral resistance mutations in drug-naive pregnant women in Yaounde, Cameroon. JAIDS, 2006