<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MDS_02UAKV131 02UAKV131 Ukraine 2002 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, G16A, E35D, M36I, R41K, L63P, H69K, L89M, I93L  
>02UAKV131| codons 1-99
PQITLWQRPLVTVRIAGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11T, K20R, V35T, E36A, T39K, D76X, K122E, D123S, A158S, S162C, K173A, Q174K, D177E, Q207A, R211S, F214L N54ND
>02UAKV131| codons 1-227
PISPIETVPVTLKPGMDGPRVKQWPLTEEKIKALTAICKEMEKEGKISKIGPEDPYNTPV
FAIKKKDSTKWRKLVYFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQCSMTKILEPFRAKNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGLTTPDKKHQKEPPF

References
Author Title Citation
Saad, MD Molecular epidemiology of HIV type 1 in Ukraine: birthplace of an epidemic. ARHR, 2006