<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MDS_02UAKV125 02UAKV125 Ukraine 2001 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 3TC|AZT|SQV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13IV, G16GA, E35D, M36I, R41K, H69K, L89M, I93L  
>02UAKV125| codons 1-99
PQITLWQRPLVTVKIAGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184MV     Y188YF K11T, E28G, V35T, E36D, T39M, K122E, D123S, K173L, Q174K, D177E, T200I, Q207A, R211S I50IS, N54ND
>02UAKV125| codons 1-235
PISPIETVPVTLKPGMDGPKVKQWPLTGEKIKALTDICMEMEKEGKISKSGPEDPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRLKNPEIVI
YQYVDDLFVGSDLEIGQHRIKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELH

References
Author Title Citation
Saad, MD Molecular epidemiology of HIV type 1 in Ukraine: birthplace of an epidemic. ARHR, 2006