<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MDS_01UAPol304 01UAPol304 Ukraine 2001 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35N, M36I, N37D, R41K, H69K, L89M, I93L  
>01UAPol304| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLENIDLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11T, V35T, T39K, E40D, D123S, K173L, Q174K, D177E, Q207A, R211S  
>01UAPol304| codons 1-238
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALTEICKDMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKSFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRLKNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDK

References
Author Title Citation
Saad, MD Molecular epidemiology of HIV type 1 in Ukraine: birthplace of an epidemic. ARHR, 2006