<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RR_MAD-TI058 MAD-TI058 Madagascar 2005 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33F I13V, K14R, K20I, E35D, M36I, R41K, K45R, R57K, L63P, C67Y, H69K, K70R, L89M  
>MAD-TI058| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVFEDINLPGKWKPRMIGGIGGFIKVKQYD
QIPIEIYGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, V60I, K122E, D123N, I135T, I142T, K173L, Q174K, V179I, Q207A, R211S, V245K, D250E  
>MAD-TI058| codons 21-250
VKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSTNNETP
GTRYQYNVLPQGWKGSPAIFQSSMTKILEPFRLKNPDIIIYQYMDDLYVGSDLEIGQHRT
KIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIKLPEKE

References
Author Title Citation
Razafindratsimandresy, R High HIV type 1 subtype diversity and few drug resistance mutations among seropositive people detected during the 2005 second generation HIV surveillance in Madagascar. ARHR, 2006