<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RR_MAD-RF272 MAD-RF272 Madagascar 2005 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10LV, K14KR, K20R, E35D, M36I, R41K, R57K, H69K, L89M  
>MAD-RF272| codons 1-99
PQITLWQRPVVTIRIGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V21I, E28A, V35T, T39L, I50IV, V60I, K101KR, K122E, D123S, I135T, K173S, Q174K, D177E, V179I, T200TI, I202V, Q207DE  
>MAD-RF272| codons 15-233
GMDGPKIKQWPLTAEKIKALTEICLEMEKEGKISKVGPENPYNTPIFAIKKKDSTKWRKL
VDFRELNKRTQDFWEVQLGIPHPAGLRKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPS
TNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIIIYQYMDDLYVGSDLE
IGQHRIKVEELREHLLRWGFTTPDKKHQKEPPFLWMGYE

References
Author Title Citation
Razafindratsimandresy, R High HIV type 1 subtype diversity and few drug resistance mutations among seropositive people detected during the 2005 second generation HIV surveillance in Madagascar. ARHR, 2006