<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RR_MAD-MO055 MAD-MO055 Madagascar 2005 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19Q, K20R, L33V, M36I, R57K, I62V, L63N, I64V, H69Y, I72V  
>MAD-MO055| codons 1-99
PQITLWQRPLVTIKIGGQQREALLDTGADDTVVEEINLPGRWKPKMIGGIGGFIKVKQYD
QVNVEICGYKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39K, V60I, D121H, K122E, K166KR, G196E, I202V, Q207A, R211K  
>MAD-MO055| codons 1-238
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRTKVEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDK

References
Author Title Citation
Razafindratsimandresy, R High HIV type 1 subtype diversity and few drug resistance mutations among seropositive people detected during the 2005 second generation HIV surveillance in Madagascar. ARHR, 2006