<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RR_MAD-GF301 MAD-GF301 Madagascar 2005 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, K14R, G16E, L19P, K20I, M36I, R41K, L63S, H69K, K70R, L89M  
>MAD-GF301| codons 1-99
PQITLWQRPVVTVRIEGQPIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QISIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39A, E40D, D86E, S162A, K173N, Q174K, D177E, I178M, T200A, Q207G, R211K  
>MAD-GF301| codons 17-235
DGPKVKQWPLTEEKIKALTEICADMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVD
FRELNKRTQEFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSIN
NETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRNKNPEMVIYQYMDDLYVGSDLEIG
QHRAKIEELRGHLLKWGFTTPDKKHQKEPPFLWMGYELH

References
Author Title Citation
Razafindratsimandresy, R High HIV type 1 subtype diversity and few drug resistance mutations among seropositive people detected during the 2005 second generation HIV surveillance in Madagascar. ARHR, 2006