<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AP_ARRP032 AP_ARRP032 Argentina 2004 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16E, E35D, M36I, N37D, R41K, R57K, Q61N, I64M, I72R, I93L  
>AP_ARRP032| codons 1-99
PQITLWQRPLVTIKIEGQLKEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVKQYD
NILMEICGHKARGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V35I, S48E, V118I, D123N, I135T, I142L, Q197K, R211G, F214L, A272P, T286A, E297K, V317A, I329V  
>AP_ARRP032| codons 1-335
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTEMEKEGKIEKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKNFRKYTAFTIPSTNNETPGLRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGKHRTKIEELRQHLLGWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTKEAE
LELAENREILKEPVHGAYYDPSKDLIAEVQKQGQG

References
Author Title Citation
Petroni, A Update on primary HIV-1 resistance in Argentina: Emergence of mutations conferring high-level resistance to nonnucleoside reverse transcriptase inhibitors in drug-naive patients. JAIDS, 2006