<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AP_ARRP006 AP_ARRP006 Argentina 2004 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, E35D, M36I, R41K, R57K, Q61N, L63C, T74S  
>AP_ARRP006| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
NICIEICGHKAIGSVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        S68G, D86DE, W88WC, K122E, I135T, S162Y, E203D, R211K, K249KQ, A272P, K275KQ, V276VI, T296S, A327V, Q334E  
>AP_ARRP006| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQEFCEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIDELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEQDSWTVNDIQKLVGKLNWASQIYPGIQIKQLCKLLRGTKALTEVIPLSEEAE
LELAENREILKEPVHGVYYDPSKDLIVEIQKQGEG

References
Author Title Citation
Petroni, A Update on primary HIV-1 resistance in Argentina: Emergence of mutations conferring high-level resistance to nonnucleoside reverse transcriptase inhibitors in drug-naive patients. JAIDS, 2006