<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AIO_DDJ278 AIO_DDJ278 Nigeria 2003 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20I, E35D, M36I, R41K, C67S, H69R, V77I, L89M  
>AIO_DDJ278| codons 1-99
PQITLWQRPLVTVKIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEISGRKAIGTVLIGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V35T, T39K, S48T, V60I, K102R, K122E, D123S, K166R, K173T, Q174R, D177E, T200E, Q207G, R211K, V245Q, E248D, D250E, S251T, A272P, I274V, K277R, Q278H, T286A, E291D, V292I, I293V, E297P, L301M, Q334L, G335E, F346Y, R356K, M357R, R358G, G359S, E370D, A371V, I375V, T386I, K390R, Q394R, A400V, E404D, K431T, V435L, F440Y  
>AIO_DDJ278| codons 1-440
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICKEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRTRNPEIVI
YQYMDDLYVGSDLEIGQHREKIEELRGHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKETWTVNDIQKLVGKLNWASQIYPGVKVRHLCKLLRGAKALTDIVPLTPEAE
MELAENREILKEPVHGVYYDPSKDLIAEIQKQGLEQWTYQIYQEPYKNLKTGKYAKRGSA
HTNDVKQLTDVVQKVATESIVIWGKIPKFRLPIRKETWEVWWTDYWQATWIPEWEFVNTP
PLVKLWYQLETEPILGAETY

References
Author Title Citation
Ojesina, AI Subtype-specific patterns in HIV type 1 reverse transcriptase and protease in Oyo State, Nigeria: Implications for drug resistance and host response. ARHR, 2006