<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AIO_DDJ191 AIO_DDJ191 Nigeria 2003 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, E35Q, M36I, N37D, R57K, L63P, C67E, H69K, V82I, L89M  
>AIO_DDJ191| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEQIDLPGRWKPKMIGGIGGFIKVKQYD
QIPIEIEGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Ojesina, AI Subtype-specific patterns in HIV type 1 reverse transcriptase and protease in Oyo State, Nigeria: implications for drug resistance and host response. ARHR, 2006