<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6007 CA64625 U.S. 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 157
2 3TC+AZT 26
3 3TC+AZT+NFV 48
4 D4T+DDI+IDV 265
5 3TC+ATV+RTV+TDF 22
6 3TC+ATV+TDF 131

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I84V, L90M L10F, L33I, N88D I13V, Q18H, K20KR, M36MI, N37D, K55R, D60E, I62V, L63P, I66F, A71V, I72T, T91TS  
>CA64625| codons 1-99
PQITLWQRPFVTVKIGGHLREALLDTGADDTVIEEIDLPGRWKPKLIGGIGGFIRVRQYE
QVPIEFCGHKVTGTVLVGPTPVNVIGRDLMSQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q     V35I, T39TAS, K64Y, K122E, I178M, T200TA, D218E, L228H, V245E, A288S, I293V, E297A, K311R, S322T, Q334H, T338S, A355G Q343QE
>CA64626| codons 1-358
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICSEMEKEGKISKIGPENPYNTPV
FAIYKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPEQKHQKEPPFHWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKSLTEVVPLTAEAE
LELAENREILREPVHGVYYDPTKDLIAEIQKQGHGQWSYQIYEEPFKNLKTGKYGRMR

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009