<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA27759 CA64169 U.S. 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 52
2 3TC+LPV+TDF 104

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46MIL, I47A, V82A, L90M L33F L10IT, I13V, M36I, R41RK, L63P, K70E, A71V, I93L  
>CA64169| codons 1-99
PQITLWQRPTVTVKIGGQLKEALLDTGADDTIFEEINLPGKWKPKLAGGIGGFIKVRQYD
QIPIEICGHEVIGTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215Y K219E Y188L K101H P4T, V60I, S68G, T69TI, V106VI, K122E, I135V, S162C, V179I, T200A, E203D, L228H, P243PH, V245E, K277R, Q278H, E297K  
>CA64170| codons 1-305
PISTIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNGIRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLHKKKSITVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIII
YQYVDDLLVGSDLEIGQHRAKIDELRQHLLRWGFYTPDEKHQKEPPFHWMGYELHPDKWT
VQHIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRHLCKLLRGTKALTEVIPLTKEAE
LELAE

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010