<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA22088 CA64070 U.S. 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 4
2 None 24
3 3TC+DDI+TDF 78
4 ABC+DDI+EFV 87

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R   K103N, Y181C, M230L   V35VI, S68N, T69S, V90I, K101KR, V106I, D177E, V179VL, Q207KR, R211Q, H221Y, A272P, V292I, I293V, P294S, E297K  
>CA64070| codons 1-305
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKRKDNSKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLRKNKSITVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEILI
CQYMDDLYVGSDLEIGQHRTKIEELRRHLLQWGFTTPDKKYQKEPPFLWLGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEIVSLTKEAE
LELAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, N37D, K43R, R57K, L63P, A71T, I93L  
>CA64069| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMDLPGRWRPKMIGGIGGFIKVKQYD
QIPIEICGHKTIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012