<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA17599 CA64053 U.S. 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+RTV 104
2 3TC+D4T+IDV 130
3 3TC+D4T+LPV 96
4 DDI+EFV+TDF 38
5 APV+DDI+RTV+TDF 41
6 3TC+AZT+DDI+LPV 44
7 Unknown 32

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, L76V, V82A L23I, F53L L10I, I15V, I62V, L63V, H69R, A71V, I72K, L89M, I93L  
>CA64053| codons 1-99
PQITLWQRPIVTIKVGGQLKEAILDTGADDTVLEEMNLPGRWKPKLIGGIGGLVKVRQYD
QVVIEICGRKVKGTVVVGPTPANIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DEKN, M184V, L210W, T215Y       S3SC, V35IT, T39TA, E44ED, S48T, S68SG, K122KE, D123E, D177E, R211KQ, A272P, K277R, I293V  
>CA64054| codons 1-301
PICPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAELEKDGKITKIGPENPYNTPV
FAIKKKNGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWQWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTEEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010