<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14311 CA64023 U.S. 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 169
2 3TC+D4T+NVP 96
3 3TC+APV+D4T 130
4 3TC+APV+D4T+DDC 43
5 3TC+APV+D4T+DDC+RTV 22
6 3TC+APV+D4T+DDC 61
7 ATV+D4T+DDC+RTV 26
8 3TC+APV+DDI+LPV+TDF 35
9 3TC+DDI+APV+LPV+TDF 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46IV, I47V, I54M, I84V, L90M L10F, V11I, G73T, L89V I13V, L19Q, K20M, L33V, E35A, M36I, R57K, I62V, L63P, I64V, T74A  
>CA64023| codons 1-99
PQITLWQRPFITVKIGGQQMEALLDTGADDTIVEAINLPGRWKPKVVGGIGGFMKVKQYD
QVPVEICGHKAITAVLVGPTPVNVIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69DE, K70RS, L74LV, M184V, T215F D67G, K219Q Y181C, G190A   E6D, V35VI, S68SG, K101Q, K102R, L109LI, K122E, I135T, I142V, T200TA, Q207R, R211Q, D218E, L228H, R284K, I293V, E297V  
>CA64024| codons 1-301
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKGGESWRKVVDFRELNKRTQDFWEVQLGIPHPAGLQRKKSVTVIDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYVDDLYVASDLEIGQHRAKIEELRRHLLQWGFFTPEQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGTKALTEVVPLTVEAE
L

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009