<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4360 CA63983 U.S. 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ SQV 7
2 D4T+ DDI+ IDV 53
3 D4T+ DDI+ IDV+ RTV 57
4 D4T+DDI+IDV+RTV+Unknown 19
5 3TC+ABC+NVP+RTV+SQV 66
6 LPV+NVP+3TC+ABC 48
7 None 17
8 3TC+LPV+TDF 5
9 Unknown 196

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10F, G73T T4TA, I15IV, K20KT, E35D, L63P, I64V, A71V, I72L, V77VI, I85V  
>CA63983| codons 1-99
PQIALWQRPFVTIKVGGQLTEALLDTGADDTVLEDMNLPGRWKPKIIGGIGGFVKVRQYD
QIPVEICGHKVLTTVLIGPTPVNVVGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70R, M184V, L210W, T215Y D67G, K219E G190A   V60I, T69N, A98S, K101Q, K122E, D123S, K126KR, I135T, I142V, A158AS, S162A, V179I, G196GR, T200TI, V245E, I293V, E297A P247PS
>CA63984| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKGSNRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLQKKKSVTVLDVGDAYFSVPL
DESFRRYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPSIFQASMTKILEPFRKQNPDIII
YQYVDDLYVASDLEIRQHRIKIEELRQHLWRWGFYTPDEKHQKEPPFLWMGYELHPDKWT
VQPIELSEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTAEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010