<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA634 CA63963 U.S. 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 157
2 AZT+DDI 157
3 D4T 104
4 AZT+DDC+SQV 13
5 3TC+D4T+IDV 56
6 3TC+NVP 5
7 3TC+AZT+RTV+SQV 37
8 3TC+AZT+EFV+RTV+SQV+Unknown 16
9 3TC+AZT+DDI+EFV+RTV+SQV+Unknown 26
10 3TC+AZT+EFV+IDV+RTV+SQV+Unknown 8
11 3TC+AZT+DDI+EFV+IDV+RTV+Unknown 11
12 3TC+AZT+DDI+IDV+RTV+Unknown 14
13 DDI+IDV+RTV 9
14 3TC+DDI+IDV+RTV 4
15 None 3
16 3TC+D4T+RTV+SQV 13
17 None 15
18 3TC+APV+D4T+LPV 148
19 Unknown 157

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, G48V, I50V, I54S, V82A L33F, K43T L10I, K20R, E34T, E35D, M36I, N37D, I62V, L63P, A71IV, I72V, V77I, I85V, I93L  
>CA63963| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVFTDIDLPGRWTPKIIVGVGGFSKVRQYD
QVPIEICGHKVVGTVLIGPTPANIVGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, V75M, M184V, L210W, T215F     A98G, V108I, V179E E6K, T39A, K43E, E44A, W88C, I94L, V118I, K122E, I135V, D177E, I178M, V189I, G196E, T200A, E203D, H208FY, R211D, H221Y, E224ED, A272P, A288P K287N
>CA63964| codons 1-292
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEEAGKISKIGPENPYNTPV
FAIKKKNSDKWRKLMDFRELNKRTQDFCEVQLGLPHPGGLKKKKSVTILDVGDAYFSIPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMEI
YQYVDDLYIGSDLEIEQHRAKIDELRQYLWDWGFFTPDKKYQKDPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTNPLTEV

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010