<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1524 CA63895 U.S. 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 17
2 AZT+DDI 13
3 None 122
4 3TC+AZT 35
5 3TC+D4T 78
6 3TC+D4T+SQV 20
7 3TC+D4T+RTV+SQV 274
8 3TC+APV+LPV+TDF 135

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48M, I54V, V82A, I84V F53L L10I, V11L, I13V, K14KR, A22V, E35D, M36I, N37D, I62V, L63P, A71V, T74S, T91S, Q92K  
>CA63895| codons 1-99
PQITLWQRPILTVRIGGQLKEVLLDTGADDTVLEDIDLPGRWKPKMIMGIGGLVKVRQYD
QVPIEICGHKVIGSVLVGPTPANVIGRNLLSKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y V75M, F77L   E138K V35T, T39E, E44D, V60I, V118I, K122E, D123N, I135T, S162X, H208Y, R211K, V245VE, A272P, K277R, T286A, E297A  
>CA63896| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEELEKDGKISKIGPENPYNTPI
FAIKKKNSDKWRKLMDLRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSTNNKTPGIRYQYNVLPQGWKGSPAIFQXSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTAEAE
L

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    D3DE, S17N, L28I, S39C, I72V, L101I, F181L, T206S  
>CA158563| codons 1-288
FLEGIDKAQEEHEKYHNNWRAMASDFNIPPVVAKEIVACCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
LIHNFKRKGGIGGYSAGERIVDIIASDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009