<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7068 CA63869 U.S. 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+SQV 104
2 3TC+AZT+IDV 26
3 ABC+APV+EFV 61
4 3TC+D4T+LPV 294

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, I84V, L90M L10F, Q58E I15V, L19I, K20R, M36I, N37D, D60DE, L63P, I64IV, A71V, P79A, I93L  
>CA63869| codons 1-99
PQITLWQRPFVTIKVGGQIREALLDTGADDTVLEEIDLPGRWKPKLIGGIGGFVKVREYE
QIPVEICGHKVIGTVLVGATPANVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74LV, M184V, L210RW, T215Y K219HN K103KN, Y181YC, G190GA V179VF T39A, K43E, E44A, K64R, V111I, V118I, K122E, I135T, D177E, E203V, Q207E, H208Y, R211K, F214FL, K223E, L228H, V245M, A272P, K277R, T286TA, I293V, P294T, E297R  
>CA63870| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEEAGKISKIGPENPYNTPV
FAIRKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDIGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIFI
CQYVDDLYVASDLEIGQHRTKIVELREYLWKWGLYTPDNKHQEEPPFHWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVVTLTREAE
L

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009