<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 DDI 56
2 AZT+DDI 31
3 3TC+AZT+RTV 52
4 3TC+AZT+NFV+NVP 21
5 3TC+AZT+NFV 52
6 3TC+D4T+EFV+NFV 26
7 3TC+D4T+IDV+RTV 57
8 3TC+ABC+D4T+DLV+LPV 122
9 3TC+ABC+LPV+TDF 146
10 FTC+LPV+TDF 43

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I84V, L90M   L10I, K20KR, E35D, M36I, R41K, L63P, H69Y, A71T, I72T, Q92K  
>CA63845| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDINLPGKWKPKIIGGIGGFIKVRQYD
QIPIEICGYKTTGTVLVGPTPVNVIGRNLMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219N K103N   K20KR, T39TA, E44D, V118I, K122E, I142V, Q174QR, D177E, G196E, Q207E, R211K, V245K, A272P, R284RK L234LP
>CA63846| codons 1-311
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICAELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKRNPEIVI
YQYVDDLYVGSDLEIEQHRTKIEELREHLWKWGFYTPDNKHQKEPPFLWMGYEPHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLKGTKALTEVIPLTEEAE
LELAENREILK

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010