<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 AZT 178
2 3TC+Unknown 122
3 NVP+Unknown 31
4 3TC+D4T+DDI+RTV+SQV 4
5 3TC+DDI+RTV+SQV 26
6 3TC+D4T+DDI+RTV+SQV 5
7 3TC+D4T+RTV+SQV 60
8 3TC+APV+D4T 31
9 3TC+D4T+LPV+NVP 228

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, I84V, L90M L10F, L33F, G73C I13V, G16A, L19IV, E34Q, N37D, I62V, I66F, A71T, I72T, P79PA, T91S, I93L  
>CA63843| codons 1-99
PQITLWQRPFVTVKIAGQIKEALLDTGADDTVFQEMDLPGRWKPKLIGGIGGFVKVRQYD
QVLIEFCGHKTTCTVLVGATPVNVIGRNLMSQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69T_SS, L74I, M184V, L210W T215H Y181C V108I P1L, V35VI, S68SG, R83RK, T139M, S162D, S163T, K166R, D177E, V179I, V189VI, I202V, R211K, A272P  
>CA63844| codons 1-311
LISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKIVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYFSVPL
DKDFRKYTAFTIPSINNEMPGIRYQYNVLPQGWKGSPAIFQDTMTRILEPFRKQNPEIII
CQYVDDLYIGSDLEIGQHRTKVEELRQHLWKWGFHTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILK

References
Author Title Citation
Rhee, SY Genotypic predictors of human immunodeficiency virus type 1 drug resistance. PNAS, 2006