<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 D4T+Unknown 28
2 ABC+D4T+Unknown 9
3 3TC+D4T+Unknown 24
4 3TC+D4T+LPV 52
5 3TC+D4T+LPV+TDF 30
6 3TC+D4T+LPV+TDF 43
7 3TC+DDI+RTV+T20+TDF+TPV 89

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    M36L, N37S, I62V, L63LP, I64V  
>CA63837| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEELSLPGRWKPKMIGGIGGFIKVRQYD
QVPVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70KR, M184V, T215Y K219Q K103KN   K32KR, V35KR, T39D, E44ED, V60I, V118VI, K122E, I135T, H208HY, R211K, D218E, K223KE, L228H, Q242QH, T286A, A288AT, I293IV  
>CA63838| codons 1-311
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIRALKEICDELEKDGKISKIGPENPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQYLLKWGFYTPEQKHQEEPPFHWMGYELHPDKWT
VHPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKTLTEVVPLTEEAE
LELAENREILK

References
Author Title Citation
Rhee, SY Genotypic predictors of human immunodeficiency virus type 1 drug resistance. PNAS, 2006