<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 AZT 109
2 AZT+DDC 65
3 AZT+DDC+SQV 65
4 D4T+DDI+NFV+NVP 4
5 D4T+DDI+NFV 35
6 3TC+AZT+IDV+RTV 131
7 3TC+ABC+EFV 48
8 ABC+D4T+EFV 122
9 3TC+ATV+RTV+TDF 62

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54T, V82A K43T L10I, I62IV, I64V, A71V, T74S, V77I  
>CA63835| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWTPKMIVGIGGFTKVRQYD
QVLVEICGHKVIGSVLIGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70KR, L74LI, M184V, L210W, T215Y K219Q     T39N, E44D, V60VI, V118VI, K122E, G196GE, T200TA, E203K, Q207E, H208Y, R211K, K223E, L228H, T286A, E297K  
>CA63836| codons 1-311
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICNELEKDGKISKIGPENPYNTPI
FAIKKKNSTRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRAKIKELREYLWKWGFYTPDQKHQEEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTKEAE
LELAENREILK

References
Author Title Citation
Rhee, SY Genotypic predictors of human immunodeficiency virus type 1 drug resistance. PNAS, 2006