<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 AZT 313
2 DDI 57
3 AZT+DDI 21
4 3TC+D4T+RTV 61
5 3TC+D4T+IDV 82
6 3TC+D4T+NVP+RTV+SQV 313
7 3TC+ATV+D4T+RTV 62

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54IV, I84V, L90M L23I, G73S L10LI, I13L, N37D, L63P, I66IV, C67CF, A71V, I72V, V77I, I93L  
>CA63831| codons 1-99
PQITLWQRPIVTLKIGGQLKEAILDTGADDTVLEEMDLPGRWKPKIIGGIGGFVKVRQYD
QIPIEVFGHKVVSTVLIGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, V75M, M184V, L210W, T215F K219W G190A K101H T39N, K43Q, V60I, V118I, D121DH, K122E, I135T, I142V, S162D, K166R, E169ED, G196E, H208FY, R211K, L228H, Q242H, V245E, A272P, L283I, A288S, E297K  
>CA63832| codons 1-311
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICNELEQEGKISKIGPENPYNTPI
FAIKKKNSDKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLHKKKSVTVLDVGDAYFSIPL
HEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQDSMTRILDPFRKQNPDIVI
YQYVDDLYVASDLEIEQHRTKIEELRQFLWKWGFFTPDWKHQKEPPFHWMGYELHPDKWT
VHPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGTKSLTEVIPLTKEAE
LELAENREILK

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010