<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+AZT+SQV 283
2 APV+D4T+DDI+RTV 200
3 3TC+ABC+ATV+EFV+RTV+TDF 25

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50V, I54IL, L90M L10F, K43T, F53L, T74P I15V, K20I, M36I, D60E, I62V, L63P, A71V  
>CA63821| codons 1-99
PQITLWQRPFVTIKVGGQLIEALLDTGADDTVLEEINLPGRWTPKIIGGVGGLLKVRQYE
QVPIEICGHKVIGPVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70G, L74LV, T215F K219Q G190S   T39A, K122P, D123E, I142V, K166R, D177E, E203EG, D218E, L228LR, A272P, V292I, E297A N137S
>CA63822| codons 1-311
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKNSTGWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DPEFRKYTAFTIPSINSETPGVRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPEIVI
YQYMDDLYVSSDLEIGQHRTKIGELRQHLLRWGFFTPEQKHQKEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEIIPLTAEAE
LELAENREILK

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010