<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+IDV 35
2 3TC+D4T+NFV+SQV 39
3 D4T+RTV+SQV 52
4 ABC+D4T+EFV+RTV+SQV 157
5 ABC+D4T+LPV 169
6 APV+FTC+MVC+NVP+RTV+T20+TDF 20

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184I, T215F K219Q Y181C, Y188L, G190A   P4S, V90I, K122E, D123Q, I135T, S162H, D177E, I178IM, V179I, T200A, R211K, F214FL, E224D, V245K, K277KR, Q278E, V292VI, E297R P1H, W24WG
>CA63820| codons 1-311
HISSIETVPVKLKPGMDGPKVKQGPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEQFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQHSMTKILEPFRKQNPEMII
CQYIDDLLVASDLEIGQHRAKIEELRQHLLKWGLFTPDQKHQKDPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRELCKLLRGTKALTEIIPLTREAE
LELAENREILK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50L, I54V, V82A, L90M L33F, K43T, G73T L10I, T12K, R41K, K55R, I62V, L63P, A71V, I72L, V77I, I93L, C95F  
>CA63819| codons 1-99
PQITLWQRPIVKIKIGGQLKEALLDTGADDTVFEEMNLPGKWTPKIIGGLGGFVRVRQYD
QVPIEICGHKVLTTVLIGPTPANIIGRNLMTQLGFTLNF

References
Author Title Citation
Rhee, SY Genotypic predictors of human immunodeficiency virus type 1 drug resistance. PNAS, 2006
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012